PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A07G2342
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 291aa    MW: 32713.2 Da    PI: 9.3565
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A07G2342genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding506.6e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+ Ed+ll+ ++k +G g W+  +++ g++R++k+c++rw++yl
      Gh_A07G2342 14 KGAWTALEDKLLASYIKTHGEGKWSDLSKRAGLKRCGKSCRLRWLNYL 61
                     79********************************************97 PP

2Myb_DNA-binding51.13.2e-1667112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+ + +E+el+++++++lG++ W++Ia +++ gRt++++k++w+++l
      Gh_A07G2342  67 RGNISHDEEELIIRLHNLLGNR-WSLIAGRLP-GRTDNEIKNYWNTVL 112
                      78999*****************.*********.************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.789961IPR017930Myb domain
SuperFamilySSF466893.48E-2812108IPR009057Homeodomain-like
SMARTSM007173.5E-131363IPR001005SANT/Myb domain
PfamPF002494.6E-151461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-221568IPR009057Homeodomain-like
CDDcd001671.02E-91661No hitNo description
PROSITE profilePS5129425.11762116IPR017930Myb domain
SMARTSM007177.6E-1666114IPR001005SANT/Myb domain
PfamPF002491.5E-1467112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.9E-2469115IPR009057Homeodomain-like
CDDcd001672.75E-1171112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MGRSPSCSKE GLNKGAWTAL EDKLLASYIK THGEGKWSDL SKRAGLKRCG KSCRLRWLNY  60
LRPDIKRGNI SHDEEELIIR LHNLLGNRWS LIAGRLPGRT DNEIKNYWNT VLRKRAKAQA  120
SIGTPPSKST QKMLSTESGV CEPLRSPRAT KAKIKVILTK ATRSSSKVRI PTQLPAAQQI  180
DKLRDGQLKS TNNNQEMSGD IATVEAHNGT QMIDSLYSDG GGSDLLNEQL KESDVEFEEN  240
LMQPLAFDEA MFKNWTVNPC LNGKDAMDFD SLAFLLEMDE YGFYRNINFQ T
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-271211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1098886200.0
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3362841e-125AF336284.1 Gossypium hirsutum GHMYB36 (ghmyb36) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012487959.10.0PREDICTED: myb-related protein 308-like
SwissprotP102901e-61MYBC_MAIZE; Anthocyanin regulatory C1 protein
TrEMBLA0A0D2PKN40.0A0A0D2PKN4_G
STRINGVIT_04s0008g01800.t011e-84(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2438634
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16720.15e-61myb domain protein 7